DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CG43775

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:137 Identity:24/137 - (17%)
Similarity:43/137 - (31%) Gaps:58/137 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAFRPCLGYNVIRSE--------AYDAHN------------DHRRTWVVP--ELIESDELSHDAE 50
            ||..|.:|:.:..:|        .:|.:.            |.:|.:.|.  .:|.:|.:|....
  Fly   139 LALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGC 203

  Fly    51 EYAI------------------HLATLNIPDQILYETAKDRNIRVDHLDYPLSEPENDFYT---- 93
            .:|:                  |....|:....:|:|.|            .:...||:.|    
  Fly   204 GFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVYKTGK------------ATTGCNDWKTIASI 256

  Fly    94 --ENICE 98
              .|:||
  Fly   257 KYSNLCE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 20/123 (16%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 14/88 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.