DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CG17974

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:121 Identity:26/121 - (21%)
Similarity:41/121 - (33%) Gaps:44/121 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NDHRRTWVVPELIESDELSHDAEEYAIH--------------------LATLNIPDQILY-ETAK 71
            |.|||  ..|:.::.|...|.|:....|                    :||:...|::.| ....
  Fly    45 NFHRR--CQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLN 107

  Fly    72 DRNIRVDHLDYPLSEPENDF-YT---ENICEFIR------------NECVYYWASE 111
            .|..::||.|.     .|.: |.   :|:|...|            .||:..|.:|
  Fly   108 TRTCKLDHDDC-----HNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 26/121 (21%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.