DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CG16995

DIOPT Version :10

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster


Alignment Length:332 Identity:64/332 - (19%)
Similarity:98/332 - (29%) Gaps:119/332 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DALAQDSGLESEYILVGCGADELIDLIMRCVLDPGEKIIDCPPT-FSMYVFDAAVNGAGVIKVPR 80
            |.|.|..|.:..|...||              .|...|:.|..: ..||........|.|..|  
  Fly   316 DYLDQAVGFQDAYNNPGC--------------SPSRSIVFCTKSLLEMYKCSWLQEVASVYGV-- 364

  Fly    81 NPDFS-LNVDRIAEVVELEKPKCIFLTSPNNPDGSIISEDDLLKILE----MPILVVLDEAYIEF 140
            .|... :.|||:        .:|:......:.|..|:.:|..|:...    .|||       .|:
  Fly   365 EPGLQCIRVDRL--------DQCMAKVRSGDADVMIVDQDSALRAERDYGLHPIL-------YEY 414

  Fly   141 SGVESRMKWVKKYENLIVLRTFSKRAGLAGLRVGY-------------GAFPLSIIEYL------ 186
            |.     ..:.||..:.|:      |..:.||.||             ||...:::..|      
  Fly   415 SS-----NALHKYLIVAVV------ARGSNLRSGYDLRNRRACFPQFEGAAHTAVLTALQNHSIG 468

  Fly   187 ------------WRAKQPYNVSVAGEVAALAALSNGKYLEDVRDALVRERERLFGLLKEVPFLNP 239
                        |::....:....||..|:..|.:|                    :.:|.|:: 
  Fly   469 DVRNFFAESSCNWKSTSRCSAVYDGEDGAMRCLQDG--------------------VADVAFVS- 512

  Fly   240 YPSYSNFILCEVTSGMDAKKLKED---LAKMGVMVRH----YNSQELKGYVRVSAGKPEHTDVLM 297
            |.:|.:.      .|.|.|:...|   .......|:|    |......|.|.:|.|..|...   
  Fly   513 YETYKSM------KGPDKKQQPTDWTIFCPFNKPVKHNALCYLGWTAVGRVMISNGTIERRQ--- 568

  Fly   298 ECLKQFY 304
               |:.|
  Fly   569 ---KEIY 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 CAP 18..172 CDD:412178 32/159 (20%)
CG16995NP_608668.2 CAP_GAPR1-like 5..125 CDD:349401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.