DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CG4270

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:167 Identity:43/167 - (25%)
Similarity:66/167 - (39%) Gaps:41/167 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EAYDAHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAKDRNIRVDHLDYPLSE 86
            |.::..|.:|.....|.:..:..|:..|:|:|.||              :|:|        .::.
  Fly    34 EVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHL--------------RDQN--------TMAH 76

  Fly    87 PENDFYTENICEFIRNEC-------VYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTE 144
            ..|..|.|||  |:....       |..|..| ..||...|.:....    |..|:.:.|||:.|
  Fly    77 RPNPKYGENI--FLSGGMDVTGDLPVEMWYRE-INSYDFNKAQFVPT----AGHFTQLIWKSSVE 134

  Fly   145 MGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYAENI 181
            ||.|.|     :|..|..:|..|:|.||..|.:.:|:
  Fly   135 MGSGVA-----RKADRTWVVCNYNPPGNVVGLFKDNV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 39/156 (25%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.