DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CG31286

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:162 Identity:45/162 - (27%)
Similarity:65/162 - (40%) Gaps:45/162 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NDHRRTWVVPELIESDELSHDAEEYAIHL---ATLNIPDQILYETAKDRNIRVDHLDYPLSEPEN 89
            |..|....||:|...:.||...:.||..|   ||||                       .|:|.|
  Fly    37 NKRRDRHGVPKLTLDNVLSKGCQSYAWKLSKSATLN-----------------------YSDPTN 78

  Fly    90 DFYTENICEF-----IRNECVYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVGW 149
            ..|||:||.|     ..:.||..|.:          .|:..:....|..|:|:.|:|:..:|.| 
  Fly    79 KDYTESICRFEVKRGALSRCVKNWYN----------GRKFDILDPKAKDFTAMIWRSSVSLGYG- 132

  Fly   150 APKDRSKKGGRKILVVRYSPAGNQPGEYAENI 181
               |.:....:.:.||||:|.||..|.|.:|:
  Fly   133 ---DANINALQGVFVVRYTPPGNVKGLYTDNV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 40/151 (26%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.