DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Crispld1

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:238 Identity:47/238 - (19%)
Similarity:68/238 - (28%) Gaps:107/238 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YNVIRSEAYD-AHNDHRRTWVVPELIESDELSHDAEEYA-----IHLATLNIPD----------- 63
            :|.:||:.|. |.|....||.|       ||...||.:|     .|..|..:|.           
  Rat    69 HNKLRSQVYPAASNMEYMTWDV-------ELERSAESWAETCLWEHGPTSLLPSIGQNLGAHWGR 126

  Fly    64 --------QILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIRNECVYYWASEGAASYGIAK 120
                    |..|:..:|       ..||. |.|.|.|    |.|                     
  Rat   127 YRPPTFHVQAWYDEVRD-------FSYPY-EHECDPY----CPF--------------------- 158

  Fly   121 ERRTKVEQSLADKFSAITWKSTTEMGVG---------WA---PKDRSKKGGRKILVVRYSPAGN- 172
                :....:...::.:.|.:::.:|..         |.   ||       ...||..|||.|| 
  Rat   159 ----RCSGPVCTHYTQVVWATSSRIGCAINLCHNMNIWGQIWPK-------AVYLVCNYSPKGNW 212

  Fly   173 ---------QP---------GEYAENIGDTEFLEYFKMPTRED 197
                     :|         |...||:...|..:.:..|..|:
  Rat   213 WGHAPYKHGKPCSACPPSFGGGCRENLCYKEGSDQYYTPQEEE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 35/186 (19%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 35/188 (19%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.