DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Crisp2

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:200 Identity:48/200 - (24%)
Similarity:75/200 - (37%) Gaps:59/200 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLFFLAFRPCL-------------GYNVIRSEAYDAHNDHRRTWVVPELIESDELSHDAEEY 52
            ::||:|.|..|..|             ....::.|..:.||:.||: |.|  ..||.|.   .|:
Mouse     6 VMLFVFALLLRSPLTEGKDPDFTSLLTNQLQVQREIVNKHNELRRS-VNP--TGSDILK---MEW 64

  Fly    53 AIHLATLNIPDQ----ILYETAKDR---NIRVDHLDYPLSEPE------NDFYTENICEFIRNEC 104
            :|. ||.|....    ||..::||.   |||.....|..::|.      ..:|.||. :|:    
Mouse    65 SIQ-ATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENE-DFV---- 123

  Fly   105 VYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVG--WAPKDRSKKGGRKILVVRY 167
                       ||:..:     ..|....::.:.|.|:.::|.|  :.|...:.|   ...|..|
Mouse   124 -----------YGVGAK-----PNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLK---YFYVCHY 169

  Fly   168 SPAGN 172
            .|.||
Mouse   170 CPMGN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 40/164 (24%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 39/165 (24%)
Crisp 189..243 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.