Sequence 1: | NP_001189140.1 | Gene: | CG42764 / 10178963 | FlyBaseID: | FBgn0261832 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001191000.1 | Gene: | Crisp2 / 22024 | MGIID: | 98815 | Length: | 243 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 75/200 - (37%) | Gaps: | 59/200 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLLFLFFLAFRPCL-------------GYNVIRSEAYDAHNDHRRTWVVPELIESDELSHDAEEY 52
Fly 53 AIHLATLNIPDQ----ILYETAKDR---NIRVDHLDYPLSEPE------NDFYTENICEFIRNEC 104
Fly 105 VYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVG--WAPKDRSKKGGRKILVVRY 167
Fly 168 SPAGN 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42764 | NP_001189140.1 | SCP | 22..172 | CDD:294090 | 40/164 (24%) |
Crisp2 | NP_001191000.1 | SCP_CRISP | 36..171 | CDD:240183 | 39/165 (24%) |
Crisp | 189..243 | CDD:285731 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.110 |