DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and scl-12

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_504056.1 Gene:scl-12 / 186714 WormBaseID:WBGene00019178 Length:208 Species:Caenorhabditis elegans


Alignment Length:188 Identity:43/188 - (22%)
Similarity:64/188 - (34%) Gaps:55/188 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAKDRNIRVDHLDYPLSEPEND 90
            ||||.|....:.        ::||      ..|:..|...:.:...|..:......|..:.|::.
 Worm    29 AHNDLRSAIALG--------NYDA------AGTIEPPAANMRKIKWDSTVASSAQQYANTCPDDH 79

  Fly    91 FYTENICEFIRNECVYY-WASEGAAS---YGIAKERRTKVEQSLADKFSAITWKST------TEM 145
            ..||      ..|.:|: |:|....|   :|:|      ...|...:|....|:||      .:.
 Worm    80 SGTE------YGENLYWSWSSSAPTSLDKFGVA------ASNSWEKEFQDYGWESTYMDADLFDS 132

  Fly   146 GVG------WAP------------KDRSKKGGRKILVV-RYSPAGNQPGEYAENIGDT 184
            |:|      ||.            ||.|.....|:.|| :|..|||.........|||
 Worm   133 GIGHATQMAWAETNKIGCGVKNCGKDSSMNNMYKVAVVCQYDQAGNMMDSDIYQSGDT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 38/174 (22%)
scl-12NP_504056.1 SCP 21..175 CDD:214553 37/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.