powered by:
Protein Alignment CG42764 and scl-8
DIOPT Version :9
Sequence 1: | NP_001189140.1 |
Gene: | CG42764 / 10178963 |
FlyBaseID: | FBgn0261832 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502510.1 |
Gene: | scl-8 / 183345 |
WormBaseID: | WBGene00008030 |
Length: | 210 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 15/57 - (26%) |
Similarity: | 25/57 - (43%) |
Gaps: | 15/57 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 131 ADKFS------------AITWKSTTEMGVGWAPKDR-SKKGG--RKILVVRYSPAGN 172
::||| .|.|..|.::|.|.....| :::|| :..:|.:|...||
Worm 124 SNKFSLALFNTGVAHATQIAWAPTGKIGCGVKNCGRDARRGGLFQVAIVCQYRVRGN 180
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42764 | NP_001189140.1 |
SCP |
22..172 |
CDD:294090 |
13/55 (24%) |
scl-8 | NP_502510.1 |
SCP |
22..175 |
CDD:214553 |
12/50 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.