DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42764 and vap-1

DIOPT Version :9

Sequence 1:	NP_001189140.1	Gene:	CG42764 / 10178963	FlyBaseID:	FBgn0261832	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_001024553.1	Gene:	vap-1 / 181768	WormBaseID:	WBGene00006886	Length:	424	Species:	Caenorhabditis elegans

Alignment Length:	135	Identity:	28/135 - (20%)
Similarity:	46/135 - (34%)	Gaps:	43/135 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    20 RSEAYDAHNDHRRTWV----------------VPELIESDELSHDAEE----------------- 51
            |...||||||.||:..                |.||....|:...|:|
Worm    33 RKMFYDAHNDARRSMAKGLEPNKCGLLSGGKNVYELNWDCEMEAKAQEWADGCPSSFQTFDPTWG 97

  Fly    52 --YAIHLATLNIPDQILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIRNECVYYWASEGAA 114
              ||.::.  :|.|.:.|.:........:.....|::|:|.:....:..|..      .|:..|:
Worm    98 QNYATYMG--SIADPLPYASMAVNGWWSEIRTVGLTDPDNKYTNSAMFRFAN------MANGKAS 154

  Fly   115 SYGIA 119
            ::|.|
Worm   155 AFGCA 159

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42764	NP_001189140.1	SCP	22..172	CDD:294090	27/133 (20%)
vap-1	NP_001024553.1	SCP	31..175	CDD:214553	28/135 (21%)
vap-1	NP_001024553.1	SCP	234..386	CDD:214553
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1528782at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010