powered by:
Protein Alignment CG42764 and CG43776
DIOPT Version :9
Sequence 1: | NP_001189140.1 |
Gene: | CG42764 / 10178963 |
FlyBaseID: | FBgn0261832 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001261162.1 |
Gene: | CG43776 / 14462630 |
FlyBaseID: | FBgn0264298 |
Length: | 270 |
Species: | Drosophila melanogaster |
Alignment Length: | 41 |
Identity: | 10/41 - (24%) |
Similarity: | 16/41 - (39%) |
Gaps: | 11/41 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 TENICEFIR--------NECVYYWASEGAAS---YGIAKER 122
:.|.|.|:. |....|.|.:.|:| :|..|.:
Fly 213 SSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKSK 253
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42764 | NP_001189140.1 |
SCP |
22..172 |
CDD:294090 |
10/41 (24%) |
CG43776 | NP_001261162.1 |
SCP_euk |
64..225 |
CDD:240180 |
3/11 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10334 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.110 |
|
Return to query results.
Submit another query.