DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Crisp1

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:247 Identity:56/247 - (22%)
Similarity:85/247 - (34%) Gaps:72/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLFFLA--FRPCLGYN---------------VIRSEAYDAHNDHRRTWVVP---ELIESDEL 45
            ::|.|||||  ..|.|..:               .::.|....||..|| .|.|   :|::. |.
Mouse     3 LMLVLFFLAAVLPPSLLQDSSQENRLEKLSTTKMSVQEEIVSKHNQLRR-MVSPSGSDLLKM-EW 65

  Fly    46 SHD----AEEYAIHLATLNIPDQILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIRNECVY 106
            ::|    |:::|......:.|.::     :..|:|..         ||.|.:.            
Mouse    66 NYDAQVNAQQWADKCTFSHSPIEL-----RTTNLRCG---------ENLFMSS------------ 104

  Fly   107 YWASEGAASYGIAKERR-------TKVEQSLADKFSAITWKSTTEM--GVGWAPKDRSKKGGRKI 162
            |.||..:|..|...|.:       .|...|:...::.:.|.||.::  ||...||:..    |..
Mouse   105 YLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPL----RYY 165

  Fly   163 LVVRYSPAGNQPGEYAENIGDTEFLEYFKMPTREDPDRWRNGSARLSYGVVD 214
            .|..|.|.||..|.........|       |....||...:|....|.|..|
Mouse   166 YVCHYCPVGNYQGRLYTPYTAGE-------PCASCPDHCEDGLCTNSCGHED 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 37/165 (22%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 36/166 (22%)
Crisp 190..244 CDD:285731 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.