DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and glipr1a

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:95 Identity:21/95 - (22%)
Similarity:34/95 - (35%) Gaps:17/95 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ENI------CEFIRNECVYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMGV----- 147
            |||      ..|.....|:.|.:| ...|.....:..  ::.:...::.:.|..:.::|.     
Zfish    96 ENIWAGAPYSRFTVKSAVFSWVNE-LKDYNYNNNQCN--DKKVCGHYTQVVWADSYKVGCAVQTC 157

  Fly   148 --GWAPKDRSKKGGRKILVVRYSPAGNQPG 175
              |.|....|...| .|.|..|:.|||..|
Zfish   158 PNGVAETHFSNIQG-VIFVCNYATAGNFAG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 18/90 (20%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.