DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and LOC101732829

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:LOC101732829 / 101732829 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:197 Identity:42/197 - (21%)
Similarity:58/197 - (29%) Gaps:70/197 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IPDQILYET-----AKDRNIRVDHLDYPLSEPENDFYTENICEFIRNECVYYWASEGAASYGI-- 118
            :|..:.|||     |.:|.|.||         .::.:..|:.....|.....|..|.|....|  
 Frog    65 VPIIVPYETQSTDNATNRQIIVD---------VHNRWRGNVTPTAMNMLKMEWNDEAAKKAEIWA 120

  Fly   119 ---------AKERRT---KVEQSLADKFSAITWKSTT--------EMGVGWAPKD---------- 153
                     |.:|..   ...|:|.....:.||::..        :...|..||.          
 Frog   121 RTCNQFHNPASQRNITNFSCGQNLFMASYSTTWEAAVTAWFDEIKDFDFGKGPKTFGALIGHYTQ 185

  Fly   154 ----RSKKGG-----------RKILVVRYSPAGNQPGEYAENIGDTEFLEYFKMPTRED-PDRWR 202
                .|:..|           |...|..|.||||..|:        :|..|...||..| |....
 Frog   186 GAWYNSRMVGCYEFECPNAEYRYYYVCHYCPAGNIEGK--------QFTPYKIGPTCGDCPKSCE 242

  Fly   203 NG 204
            ||
 Frog   243 NG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 31/162 (19%)
LOC101732829XP_017949574.2 CAP 80..217 CDD:412178 24/145 (17%)
Crisp 234..289 CDD:400739 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.