DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and crisp1.6

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002933627.1 Gene:crisp1.6 / 100379939 XenbaseID:XB-GENE-5838744 Length:237 Species:Xenopus tropicalis


Alignment Length:165 Identity:34/165 - (20%)
Similarity:52/165 - (31%) Gaps:51/165 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AEEYAIHL-ATLNIPDQILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIRNECVYYWASEG 112
            |..:.||. :|..:|..:...|:..:.:.||         .::.|..::....||.....| ||.
 Frog     9 AMPFIIHAQSTGTLPSSLWTTTSTVQQVIVD---------THNGYRRSVNPSARNMLKMMW-SEA 63

  Fly   113 AASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEY 177
            |||                   :|.||.:|       .|...|....|.|..|            
 Frog    64 AAS-------------------NAATWSAT-------CPAAHSPTSQRTISGV------------ 90

  Fly   178 AENIGDTEFLEYFKMPTREDPDRWRNGSARLSYGV 212
              ..|:..|:..:....:|....|.:.|....|||
 Frog    91 --TCGENIFIASYPASWQEAITAWNSESQYFQYGV 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 26/123 (21%)
crisp1.6XP_002933627.1 CAP_CRISP 32..166 CDD:349402 28/142 (20%)
Crisp 183..236 CDD:369954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.