DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and crispld1a

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:193 Identity:39/193 - (20%)
Similarity:58/193 - (30%) Gaps:75/193 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YNVIRSEAY-DAHNDHRRTWVVPELIESDELSHDAEEYA---------------------IHLAT 58
            :|.:|.:.| .|.|.....|       .:||...|||:|                     :|...
Zfish    74 HNKLRGQVYPPASNMEYMVW-------DNELERSAEEWAETCLWEHGPAGLLPQIGQNLGVHWGR 131

  Fly    59 LNIPD---QILYETAKDRNIRV-----DHLDYPLSEPENDFYTENICEFIRNECVYYWASEGAAS 115
            ...|.   |..|:..||.:...     .|..:..|.|....||:.:           ||:.    
Zfish   132 YRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHYTQLV-----------WATS---- 181

  Fly   116 YGIAKERRTKVEQSLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYA 178
                    :::..::...::...|      |..||.        ...||..|||.||..| ||
Zfish   182 --------SRIGCAINVCYNMNVW------GQIWAK--------AVYLVCNYSPKGNWWG-YA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 32/179 (18%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 31/181 (17%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.