DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pre-mod(mdg4)-V and pre-mod(mdg4)-Z

DIOPT Version :10

Sequence 1:NP_001189262.3 Gene:pre-mod(mdg4)-V / 10178950 FlyBaseID:FBgn0261844 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001189256.2 Gene:pre-mod(mdg4)-Z / 10178929 FlyBaseID:FBgn0261838 Length:123 Species:Drosophila melanogaster


Alignment Length:49 Identity:17/49 - (34%)
Similarity:23/49 - (46%) Gaps:1/49 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FIFEKTLK-LSSGEEKRFWRCNQWWNQKCRSRVFTINDVVCPLNRFHTH 70
            |::...|| ........:|.|.|..:.|||||:.||.|.:...|..|.|
  Fly    27 FVYRSNLKFFGKSNNILYWECVQNRSVKCRSRLKTIGDDLYVTNDVHNH 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pre-mod(mdg4)-VNP_001189262.3 FLYWCH 6..70 CDD:461332 16/47 (34%)
pre-mod(mdg4)-ZNP_001189256.2 FLYWCH 12..75 CDD:461332 16/47 (34%)

Return to query results.
Submit another query.