DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42792 and CG44475

DIOPT Version :10

Sequence 1:NP_001188820.1 Gene:CG42792 / 10178946 FlyBaseID:FBgn0261925 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001285967.1 Gene:CG44475 / 19835392 FlyBaseID:FBgn0265668 Length:81 Species:Drosophila melanogaster


Alignment Length:88 Identity:75/88 - (85%)
Similarity:78/88 - (88%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPKFALAVLLLSCVLLGLANAQYNRRYQTGPNRQKIGTRMNADGPLPPNFPPPADNAGGSDVPA 65
            ||||||||:||||||||||||||||||:|.||||.||||||||||       |||.|||||||||
  Fly     1 MSPKFALAILLLSCVLLGLANAQYNRRHQPGPNRPKIGTRMNADG-------PPAGNAGGSDVPA 58

  Fly    66 NVDCMPNLLASNTLDTRKPRPKH 88
            |||||||||||||||||:|||||
  Fly    59 NVDCMPNLLASNTLDTRRPRPKH 81

Return to query results.
Submit another query.