DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG34428

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:232 Identity:60/232 - (25%)
Similarity:89/232 - (38%) Gaps:40/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGALLSLWSILRPILAELPLLFPASSVYQITSSLSVPVV----IPDRKLFWD-----WGLQMNYA 64
            |.:|.||:...|...|.:|.|     :|..||...|..:    ||...|.::     :.|::.|.
  Fly    18 MASLGSLFKHQRSKRAPIPWL-----IYPTTSPTRVMFIGGIGIPLEDLNYEAVTTGYVLKVEYW 77

  Fly    65 LPAEPSSFYAAT-------IWPDEFSRRRKR------------QLWNETAKYLPEGVSTMHPSDF 110
            ||..|......|       ..|.....|::|            :|...|.|.|......:....:
  Fly    78 LPTTPDDLRTPTALPLTQVATPGVTGARKQRKPMFENFLVGVDELGKNTRKLLTRTNKVLSSYRW 142

  Fly   111 TAGELYESLENMLIQYGFD-ESCLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFAPGEN 174
            |   :|:.||.:..:.|:. ..|:|:|:||.|..|| ...|.:...||...|||| .......|:
  Fly   143 T---VYKGLEGLADRLGYQGRICVLKSICEAAEEPF-HYTNGLFADLLHILLTPS-SSVDKLSEH 202

  Fly   175 VYREVYEHAEQQGFLGMDCGHLYSNCPVDFLSGISSL 211
            ...|.| :||:.|..|..|..::..|....|...|.|
  Fly   203 ADNEYY-YAEKMGQSGAGCDRVFKECRRSLLQHFSEL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 29/99 (29%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.