DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG42812

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097901.2 Gene:CG42812 / 50072 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster


Alignment Length:194 Identity:88/194 - (45%)
Similarity:122/194 - (62%) Gaps:9/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLFPASSVYQITSSLSVPV--VIPDRKLFWDWGLQMNYALPAEPSSFYAATIWPDEFSRRRKRQL 90
            ||:||||...:|.|:|.|:  :.|:|::..||...::|..|...:.||:..|||...:.:.||::
  Fly    22 LLWPASSNLGLTLSVSTPIAELYPERRILIDWCFAISYNYPYNLTEFYSIPIWPGFANYKAKREV 86

  Fly    91 -------WNETAKYLPEGVSTMHPSDFTAGELYESLENMLIQYGFDESCLLRSVCELARHPFKDV 148
                   .|...||..:..:.|||.||:|||||..||:.|..|||.|:||||||||||:|||.|.
  Fly    87 PQLEMTDENFYTKYGHDNGNGMHPKDFSAGELYAFLEDTLTGYGFHETCLLRSVCELAQHPFDDS 151

  Fly   149 ENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLYSNCPVDFLSGISSLL 212
            ..::|:.::||.|:||.||.|...|:|||:.||.|||.||||.||..|||:|..|.|..:|.::
  Fly   152 HQHLLSDIVTFVLSPSQHEGFRDDEDVYRKAYELAEQDGFLGRDCLRLYSHCKHDILQLMSQVI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 58/98 (59%)
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 59/99 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469011
Domainoid 1 1.000 81 1.000 Domainoid score I15299
eggNOG 1 0.900 - - E1_2C43J
Homologene 1 1.000 - - H129747
Inparanoid 1 1.050 112 1.000 Inparanoid score I7207
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120231at33392
OrthoFinder 1 1.000 - - FOG0016872
OrthoInspector 1 1.000 - - mtm9698
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10547
1110.900

Return to query results.
Submit another query.