DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG17784

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 / 42909 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster


Alignment Length:201 Identity:52/201 - (25%)
Similarity:89/201 - (44%) Gaps:47/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLWSILRPILAELPLLFPASSVYQITSSLSVPVVIPDRK--LFWDWGLQMNYALPAEPSSFYAAT 76
            ||.|:.|   ::...::....|.::..||:.||...|::  .:|.:.||..: :|.....::   
  Fly    53 SLTSLSR---SKRVAIYNGQGVVKLVPSLAYPVKQTDKEQSFWWFFNLQGQW-IPTTIPLYW--- 110

  Fly    77 IWPDEFSRRRKRQLWNETAKYLPEGVSTMHP--SDFTAGELYESLENML---IQYGFDE------ 130
             |          ..||.||     .|||...  .|..|..|::.....:   |:.|.::      
  Fly   111 -W----------SFWNTTA-----FVSTAREWRKDMQAKVLHDEARTWVYNAIEVGMEQLDGAYG 159

  Fly   131 -SCLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCG 194
             .|||||:||:::.||::  :|:.:.::...|.|:|       :||..: |.||...|..|.||.
  Fly   160 GVCLLRSICEISQKPFQN--SNIFSEIVNAVLVPTL-------DNVASK-YLHARDAGRGGADCE 214

  Fly   195 HLYSNC 200
            ..||:|
  Fly   215 RTYSDC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 30/106 (28%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 28/96 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.