DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG7201

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:228 Identity:58/228 - (25%)
Similarity:88/228 - (38%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PILAELPLLFPASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALPAEPSSFYAATIWPD----- 80
            |.:| :||:......:....::|.||.|...||    ||..|.....:....:|.:...:     
  Fly    92 PTIA-MPLVRHPPEGFFSNLTISFPVTIDFDKL----GLTDNQNPLGDLPPLFARSFGHEAGHMV 151

  Fly    81 -EF------SRRRKRQL---------------WNETAKY--LPEGVSTMHPSDFTAGE---LYES 118
             |:      .:||||.|               ..|..||  ||.|:..:    |..||   ||..
  Fly   152 GEYVARYLHVQRRKRDLSEQRSRSNEDHPFRIHEEGPKYPELPAGLQHI----FHGGERVLLYGV 212

  Fly   119 LENMLIQYGFD-ESCLLRSVCELARHPFK--DVENNMLTALLTFTLTPSLHEAFAPGENVYREVY 180
            :|:.|..:|.| ::||||::||:.....:  .|...|....||.|.:|  .....|.....:||.
  Fly   213 VEDFLSTFGMDGKACLLRTICEMHSRSLEKFGVFGEMTKLFLTVTKSP--FSDLVPDYVQAQEVG 275

  Fly   181 EHAEQQGFLGMDCGHLYSNCPVDFLSGISSLLS 213
            |..:..|    :|...:.:||......:||..|
  Fly   276 EGKQAPG----ECFPYFKDCPKSIFKALSSKYS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 29/104 (28%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.