DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG33262

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:188 Identity:46/188 - (24%)
Similarity:74/188 - (39%) Gaps:55/188 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLFP--ASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALPAEPSSFYAATIWPDEFSRRRKRQL 90
            |:||  |.:.:|..:.:.:|..:....|...:.|:..|.||      |.||::       |:..|
  Fly    34 LIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAEYYLP------YNATVY-------RQNPL 85

  Fly    91 WNETAKYLPEGVST-------MHPSDFTAGELYESLENMLIQYGFD-ESCLLRSVCELARHPFKD 147
            :.|   |.|..:..       |.|:|. ..:||:.:|:||..||.: .:|||.::||        
  Fly    86 FPE---YKPNTIDAQDQRKLFMKPTDL-RWQLYQFIEHMLNGYGLNGHACLLEAICE-------- 138

  Fly   148 VENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLYSNCPVDFL 205
             .||:..|....|....||...:|...:..|                   ||..:||:
  Fly   139 -ANNIKFAKDFSTAGEMLHLLLSPSSTLNSE-------------------SNRALDFI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 26/100 (26%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.