DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42828 and Tfpi2

DIOPT Version :10

Sequence 1:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001368837.1 Gene:Tfpi2 / 21789 MGIID:108543 Length:266 Species:Mus musculus


Alignment Length:79 Identity:25/79 - (31%)
Similarity:41/79 - (51%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LCLLAVLLSTVES-----AEKRK---AFCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGN 64
            ||...:.:.:.|:     .|.||   :||..|.:.|.|..:...:.|:::.:.|..|.::.||||
Mouse   164 LCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGN 228

  Fly    65 ENRFYTKENCEKAC 78
            ||.||..:.|.:||
Mouse   229 ENNFYYLDACHRAC 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42828NP_001189271.1 KU 27..78 CDD:197529 17/50 (34%)
Tfpi2NP_001368837.1 Kunitz_TFPI2_1-like 68..124 CDD:438659
Kunitz-type 129..182 CDD:444694 3/17 (18%)
Kunitz_TFPI1_TFPI2_3-like 189..242 CDD:438658 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.