DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42828 and Col28a1

DIOPT Version :10

Sequence 1:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:83 Identity:24/83 - (28%)
Similarity:38/83 - (45%) Gaps:15/83 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAVLLSTVESAEKR----------KAF-----CYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSN 60
            |..|||:.|..|.|          |:.     |....:.|:||.:.:.|.:..:...|..|.||.
Mouse  1056 LEPLLSSREGVETRTPNPNLLQSEKSLYKDPRCEEALKPGECGDYVVRWYYDKQVNSCARFWFSG 1120

  Fly    61 CGGNENRFYTKENCEKAC 78
            |.|:.|||::::.|.:.|
Mouse  1121 CNGSGNRFHSEKECRETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42828NP_001189271.1 KU 27..78 CDD:197529 15/55 (27%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.