| Sequence 1: | NP_001189115.1 | Gene: | CG42717 / 10178897 | FlyBaseID: | FBgn0261634 | Length: | 96 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006278.1 | Gene: | TFPI / 7035 | HGNCID: | 11760 | Length: | 304 | Species: | Homo sapiens |
| Alignment Length: | 46 | Identity: | 19/46 - (41%) |
|---|---|---|---|
| Similarity: | 28/46 - (60%) | Gaps: | 3/46 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 CKKSANKNMWHYNTRTKNCTQFNYLGCGGNNNRWCTKALC-EACRR 94 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42717 | NP_001189115.1 | Kunitz-type | <57..90 | CDD:444694 | 14/33 (42%) |
| TFPI | NP_006278.1 | Kunitz_TFPI1_1-like | 51..105 | CDD:438656 | |
| Kunitz_TFPI1_2-like | 121..176 | CDD:438657 | |||
| Kunitz_TFPI1_TFPI2_3-like | 214..267 | CDD:438658 | 17/42 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||