| Sequence 1: | NP_001189115.1 | Gene: | CG42717 / 10178897 | FlyBaseID: | FBgn0261634 | Length: | 96 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_857593.1 | Gene: | SPINT1 / 6692 | HGNCID: | 11246 | Length: | 529 | Species: | Homo sapiens |
| Alignment Length: | 45 | Identity: | 18/45 - (40%) |
|---|---|---|---|
| Similarity: | 28/45 - (62%) | Gaps: | 3/45 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 CKKSANKNMWHYNTRTKNCTQFNYLGCGGNNNRWCTKALC-EACR 93 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42717 | NP_001189115.1 | Kunitz-type | <57..90 | CDD:444694 | 12/33 (36%) |
| SPINT1 | NP_857593.1 | MANEC | 50..139 | CDD:462186 | |
| Kunitz_HAI1_1-like | 245..303 | CDD:438666 | |||
| LDLa | 334..366 | CDD:197566 | |||
| Kunitz_HAI1_2-like | 390..450 | CDD:438667 | 18/45 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||