DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42717 and SPINT1

DIOPT Version :10

Sequence 1:NP_001189115.1 Gene:CG42717 / 10178897 FlyBaseID:FBgn0261634 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens


Alignment Length:45 Identity:18/45 - (40%)
Similarity:28/45 - (62%) Gaps:3/45 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CKKSANKNMWHYNTRTKNCTQFNYLGCGGNNNRWCTKALC-EACR 93
            ||:|..:  |:||..:::|.:|.|.||.||.|.:..:..| |:||
Human   400 CKESIPR--WYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCR 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42717NP_001189115.1 Kunitz-type <57..90 CDD:444694 12/33 (36%)
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.