DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42717 and CG15418

DIOPT Version :10

Sequence 1:NP_001189115.1 Gene:CG42717 / 10178897 FlyBaseID:FBgn0261634 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster


Alignment Length:34 Identity:15/34 - (44%)
Similarity:17/34 - (50%) Gaps:3/34 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YNTRTKNCTQFNYLGCGGNNNRWCTKALCEACRR 94
            ||.:|.||..|.|.||....|.:.|   .|.|||
  Fly    59 YNKKTGNCESFIYTGCASTENNFLT---FEECRR 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42717NP_001189115.1 Kunitz-type <57..90 CDD:444694 11/28 (39%)
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 15/34 (44%)

Return to query results.
Submit another query.