| Sequence 1: | NP_001189115.1 | Gene: | CG42717 / 10178897 | FlyBaseID: | FBgn0261634 | Length: | 96 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035594.1 | Gene: | Spint2 / 20733 | MGIID: | 1338031 | Length: | 252 | Species: | Mus musculus |
| Alignment Length: | 31 | Identity: | 12/31 - (38%) |
|---|---|---|---|
| Similarity: | 18/31 - (58%) | Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 59 WHYNTRTKNCTQFNYLGCGGNNNRWCTKALC 89 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42717 | NP_001189115.1 | Kunitz-type | <57..90 | CDD:444694 | 12/31 (39%) |
| Spint2 | NP_035594.1 | Kunitz_HAI2_1-like | 36..88 | CDD:438664 | |
| Kunitz_HAI2_2-like | 131..183 | CDD:438665 | 12/31 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||