DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42717 and Spint2

DIOPT Version :10

Sequence 1:NP_001189115.1 Gene:CG42717 / 10178897 FlyBaseID:FBgn0261634 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_035594.1 Gene:Spint2 / 20733 MGIID:1338031 Length:252 Species:Mus musculus


Alignment Length:31 Identity:12/31 - (38%)
Similarity:18/31 - (58%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WHYNTRTKNCTQFNYLGCGGNNNRWCTKALC 89
            |:|:|...:|..|.|.||.||.|.:.::..|
Mouse   149 WYYDTEKNSCISFIYGGCRGNKNSYLSQEAC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42717NP_001189115.1 Kunitz-type <57..90 CDD:444694 12/31 (39%)
Spint2NP_035594.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 131..183 CDD:438665 12/31 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.