DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42717 and SPINT3

DIOPT Version :10

Sequence 1:NP_001189115.1 Gene:CG42717 / 10178897 FlyBaseID:FBgn0261634 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens


Alignment Length:44 Identity:17/44 - (38%)
Similarity:22/44 - (50%) Gaps:2/44 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KSKCKKSANKNMWHYNTRTKNCTQFNYLGCGGNNNRWCTKALCE 90
            |..|:....:  |.:|..|..|..|.|.|||||:|.:..|..||
Human    42 KGPCQTYMTR--WFFNFETGECELFAYGGCGGNSNNFLRKEKCE 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42717NP_001189115.1 Kunitz-type <57..90 CDD:444694 13/32 (41%)
SPINT3NP_006643.1 Kunitz_BPTI 35..87 CDD:425421 17/44 (39%)

Return to query results.
Submit another query.