DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d2 and B9D1

DIOPT Version :10

Sequence 1:NP_001188704.1 Gene:B9d2 / 10178891 FlyBaseID:FBgn0261683 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_047291706.1 Gene:B9D1 / 27077 HGNCID:24123 Length:213 Species:Homo sapiens


Alignment Length:66 Identity:15/66 - (22%)
Similarity:29/66 - (43%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 LEERSKTPIPKLFV--GYLNENAYVDDDDHVRKINLENAIQVLCEM--------IKRIEKYASSE 603
            ||....:|:|.:.|  |.::....|.......:|:..:|.:.|.|:        |:.:|:.|..|
Human   230 LESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGE 294

  Fly   604 K 604
            :
Human   295 R 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d2NP_001188704.1 B9-C2 4..165 CDD:462108
B9D1XP_047291706.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.