DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and Sfp23F

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001162856.1 Gene:Sfp23F / 8674054 FlyBaseID:FBgn0259949 Length:78 Species:Drosophila melanogaster


Alignment Length:33 Identity:9/33 - (27%)
Similarity:17/33 - (51%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            |.:.||.|....::.|..:...:.::.||:.||
  Fly    44 YLRWENMCTSKNFVACDTDGTSFESIKECEDKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 7/31 (23%)
Sfp23FNP_001162856.1 Kunitz-type 32..78 CDD:444694 9/33 (27%)

Return to query results.
Submit another query.