DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and CG42465

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster


Alignment Length:52 Identity:14/52 - (26%)
Similarity:23/52 - (44%) Gaps:10/52 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CNRDPNPQ--------MWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            ||.:|..|        ::.|.:.:|.|:  .:.||..|.|.:....||:..|
  Fly    22 CNLEPFVQGSCLELTDLYSYVEYKNDCV--YWQGCLLNGNHFSKKEECEDMC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 13/50 (26%)
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 13/50 (26%)

Return to query results.
Submit another query.