DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and spint1b

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001104693.2 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:501 Species:Danio rerio


Alignment Length:90 Identity:27/90 - (30%)
Similarity:34/90 - (37%) Gaps:26/90 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CPGRPSHQNCLHGKDE----------------GVERARHCNRDP--NP-----QMWYYNQRENRC 63
            |.|   ||.|..|.||                .|.:..||...|  .|     ..|||:....:|
Zfish   329 CDG---HQECSDGSDEKNCQQLNESLTRLLKIEVNKKAHCTDPPATGPCRAHFHHWYYDPLSKKC 390

  Fly    64 IKMRYLGCKGNRNRYCTLNECQRKC 88
            ....|.||.||||.:.|.::|.:.|
Zfish   391 HPFTYGGCDGNRNNFETADKCMKNC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 22/79 (28%)
spint1bNP_001104693.2 None

Return to query results.
Submit another query.