DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and TFPI

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_006278.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens


Alignment Length:58 Identity:21/58 - (36%)
Similarity:27/58 - (46%) Gaps:7/58 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            ||...|.|:.||       |...:|||....:|...:|.||.||.|.:.:..||.|.|
Human   217 CLTPADRGLCRA-------NENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRAC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 20/56 (36%)
TFPINP_006278.1 Kunitz_TFPI1_1-like 51..105 CDD:438656
Kunitz_TFPI1_2-like 121..176 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 214..267 CDD:438658 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.