powered by:
Protein Alignment CG42713 and Crisp1
DIOPT Version :9
Sequence 1: | NP_001188736.1 |
Gene: | CG42713 / 10178890 |
FlyBaseID: | FBgn0261630 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001034482.2 |
Gene: | Crisp1 / 654517 |
RGDID: | 1590757 |
Length: | 254 |
Species: | Rattus norvegicus |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 23/47 - (48%) |
Gaps: | 11/47 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 PSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIK-MRYLGC 71
|..|:|.:..::|: |. ||.::| ...|.|.| ::.|||
Rat 198 PPCQDCPNNCEDGL-----CT---NPCLYY--DEYNNCDKQVKLLGC 234
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42713 | NP_001188736.1 |
KU |
<54..89 |
CDD:294074 |
7/19 (37%) |
Crisp1 | NP_001034482.2 |
SCP |
46..182 |
CDD:294090 |
|
Crisp |
200..254 |
CDD:285731 |
13/45 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.