DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and Spint3

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001170872.1 Gene:Spint3 / 629747 MGIID:3651470 Length:88 Species:Mus musculus


Alignment Length:86 Identity:26/86 - (30%)
Similarity:37/86 - (43%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMR 67
            |.|.|..:......:...:.|.:.....|:..||.|..||....       ||||.:..:|...|
Mouse     7 FFLFLILIFCQELCAEPNNVPRKSLPPMCILPKDIGGCRAVFVR-------WYYNSKTGKCEWFR 64

  Fly    68 YLGCKGNRNRYCTLNECQRKC 88
            |.|||||.|.:.:.::||..|
Mouse    65 YGGCKGNENNFPSRSQCQAVC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 21/56 (38%)
Spint3NP_001170872.1 Kunitz_actitoxin-like 31..85 CDD:438676 21/60 (35%)

Return to query results.
Submit another query.