DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and EPPIN

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_065131.1 Gene:EPPIN / 57119 HGNCID:15932 Length:133 Species:Homo sapiens


Alignment Length:128 Identity:27/128 - (21%)
Similarity:48/128 - (37%) Gaps:49/128 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILASVVLYVALSSAQS-----------CPGRPSHQNCLHGKDEGVERARHCN------------- 46
            :|:.:||:|.|::.|.           ||  ...:.|...:.:...:.|.|.             
Human     6 LLSLLVLFVLLANVQGPGLTDWLFPRRCP--KIREECEFQERDVCTKDRQCQDNKKCCVFSCGKK 68

  Fly    47 ------------RDPNPQM-----WYYNQRENRCIKMRYLGCKGNRNRY-----CTLNECQRK 87
                        ::..|.:     |:|::::|.|....|.||:||.|.:     | ||.|:.|
Human    69 CLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANC-LNTCKNK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 19/92 (21%)
EPPINNP_065131.1 Kunitz_eppin 75..131 CDD:438654 16/57 (28%)

Return to query results.
Submit another query.