DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and Ppn

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_061503172.1 Gene:Ppn / 5667695 VectorBaseID:AGAMI1_011200 Length:2587 Species:Anopheles gambiae


Alignment Length:77 Identity:20/77 - (25%)
Similarity:28/77 - (36%) Gaps:22/77 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GKDEGVERARHCNR----------------------DPNPQMWYYNQRENRCIKMRYLGCKGNRN 76
            |.....:|...|.|                      ..|.:.|:|...|.||::..|.||.||.|
Mosquito  1844 GNGNNFQRKEECERSCGSEGQGEQDVCQLPHAYGECSGNEERWFYEPHEQRCVRFAYSGCGGNGN 1908

  Fly    77 RYCTLNECQRKC 88
            .:.:..||:|.|
Mosquito  1909 NFASEAECERSC 1920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 19/75 (25%)
PpnXP_061503172.1 None

Return to query results.
Submit another query.