DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and spint1a

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:62 Identity:25/62 - (40%)
Similarity:32/62 - (51%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            |..:||..|.||     .| |...|: |:||....:|.:.::.||..|||.|..|||||..|
Zfish   243 SLHHCLVPKKEG-----PC-RGSFPR-WHYNAATEKCEEFKFGGCVPNRNNYLALNECQSAC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 23/56 (41%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.