DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and ambp

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:76 Identity:22/76 - (28%)
Similarity:35/76 - (46%) Gaps:11/76 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CPGR----PSHQNCLHGKDEGVERARHCNRDPNP-----QMWYYNQRENRCIKMRYLGCKGNRNR 77
            |.|.    |:.::||  :....|.|.....|..|     .:|.::....:|:.::|.|||||.||
Zfish   258 CMGNQNNFPTEKDCL--QSCRTEAACRLPMDAGPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNR 320

  Fly    78 YCTLNECQRKC 88
            :.:..||...|
Zfish   321 FYSKKECDEYC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 18/61 (30%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639 5/19 (26%)
Kunitz_bikunin_2-like 278..332 CDD:438640 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.