DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and glipr1b

DIOPT Version :9

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:140 Identity:27/140 - (19%)
Similarity:39/140 - (27%) Gaps:60/140 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLILASVVLYVALSSAQSCPG--RPSH-QNCLHGKD----------------------------- 36
            ||:..|||||.:.|.....||  .|.. :.|:...:                             
Zfish     7 LLLRISVVLYGSCSVLALLPGITEPEFIRRCVKAHNTHRARVSPPAAGARSMVRQVFGMQSWDKE 71

  Fly    37 --EGV-ERARHCNRDPNPQMWYYNQR--------------------ENRCIKMRYLGCKGNRNRY 78
              :|. :|||||.....|.:.::...                    ||...:....|....:|  
Zfish    72 LAKGARDRARHCKGSHYPSLGHFGHPLFGWMGENIWLGSPFSAFSVENAVHRWSKEGAYSVKN-- 134

  Fly    79 CTLNECQRKC 88
               |.|.|.|
Zfish   135 ---NNCSRLC 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 KU <54..89 CDD:294074 8/55 (15%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 16/115 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.