DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and K11D12.13

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001033498.1 Gene:K11D12.13 / 3896821 WormBaseID:WBGene00044535 Length:188 Species:Caenorhabditis elegans


Alignment Length:35 Identity:12/35 - (34%)
Similarity:20/35 - (57%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            ::::.:.|.|...:|.||.||.|.|.|..:|.:.|
 Worm    42 YHFDPKTNICHAFKYEGCGGNVNNYETPGDCGQNC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 11/33 (33%)
K11D12.13NP_001033498.1 Kunitz-type 22..76 CDD:438633 11/33 (33%)

Return to query results.
Submit another query.