powered by:
Protein Alignment CG42713 and CG43775
DIOPT Version :9
Sequence 1: | NP_001188736.1 |
Gene: | CG42713 / 10178890 |
FlyBaseID: | FBgn0261630 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_726425.3 |
Gene: | CG43775 / 37863 |
FlyBaseID: | FBgn0264297 |
Length: | 272 |
Species: | Drosophila melanogaster |
Alignment Length: | 33 |
Identity: | 8/33 - (24%) |
Similarity: | 14/33 - (42%) |
Gaps: | 9/33 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 YYNQRENRC--IKMRYLGCK-------GNRNRY 78
|.|.|.:.| .:.::..|: |.|.:|
Fly 23 YCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKY 55
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42713 | NP_001188736.1 |
KU |
<54..89 |
CDD:294074 |
8/33 (24%) |
CG43775 | NP_726425.3 |
SCP_euk |
66..228 |
CDD:240180 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.