DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and tfpia

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001296732.1 Gene:tfpia / 359833 ZFINID:ZDB-GENE-030711-1 Length:279 Species:Danio rerio


Alignment Length:62 Identity:21/62 - (33%)
Similarity:31/62 - (50%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKCV 89
            ||:|...||||..:|.       ...:|::....||....|.||:||.|.:.||.:|:..|:
Zfish    39 HQSCALKKDEGPCKAM-------KDRFYFDIDTGRCEPFEYGGCQGNANNFETLQDCEEMCL 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 18/56 (32%)
tfpiaNP_001296732.1 Kunitz_TFPI1_1-like 39..93 CDD:438656 20/60 (33%)
Kunitz-type 101..151 CDD:438633
Kunitz-type 202..255 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.