DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and CG10651

DIOPT Version :9

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:77 Identity:20/77 - (25%)
Similarity:28/77 - (36%) Gaps:21/77 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CLHGKDEGVERARHCNRDPNPQ--------MWYYNQRENRCIKMRYLGCKGNR-NRY-CTLNECQ 85
            |:..|.|.:.:......|||.:        .|..||:|   :...|.....:| ||. |.:.|..
  Fly   135 CMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQE---LSKNYFQVLRDRANRVGCAIVEYV 196

  Fly    86 R--------KCV 89
            |        |||
  Fly   197 RPALVHQLLKCV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 KU <54..89 CDD:294074 12/44 (27%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.