powered by:
Protein Alignment CG42713 and CLEC18A
DIOPT Version :9
Sequence 1: | NP_001188736.1 |
Gene: | CG42713 / 10178890 |
FlyBaseID: | FBgn0261630 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016878695.1 |
Gene: | CLEC18A / 348174 |
HGNCID: | 30388 |
Length: | 476 |
Species: | Homo sapiens |
Alignment Length: | 68 |
Identity: | 15/68 - (22%) |
Similarity: | 21/68 - (30%) |
Gaps: | 27/68 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 PGRPSHQNCL-HGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQR 86
|..|...:|. ||: ..:... ||:..| |...|||.: .|..
Human 228 PRNPCRMSCQNHGR-LNISTC-HCHCPP-----------------------GYTGRYCQV-RCSL 266
Fly 87 KCV 89
:||
Human 267 QCV 269
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42713 | NP_001188736.1 |
KU |
<54..89 |
CDD:294074 |
5/34 (15%) |
CLEC18A | XP_016878695.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.