DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and COL28A1

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:37 Identity:14/37 - (37%)
Similarity:24/37 - (64%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKCVR 90
            |||:::.|.|.:..:.||.|:.||:.:..|||..|::
Human  1088 WYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETCIQ 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 13/33 (39%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066
Kunitz-type 1072..1122 CDD:444694 13/33 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.