DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and CG2816

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:37 Identity:14/37 - (37%)
Similarity:19/37 - (51%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            :.:.||..:..|....|.||.||.||:.|..||:..|
  Fly    45 ESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 13/35 (37%)
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 13/35 (37%)

Return to query results.
Submit another query.