DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and IM33

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster


Alignment Length:33 Identity:15/33 - (45%)
Similarity:19/33 - (57%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            |:...|.|.|..|.||.||.||:.|...|::||
  Fly    48 YHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 13/31 (42%)
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 13/31 (42%)

Return to query results.
Submit another query.